DENND4C Peptide - C-terminal region
DENND4C Peptide - C-terminal region
Product Specifications
UniProt
Q5VZ89
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DENND4C Rabbit Polyclonal Antibody (orb331377) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KHNQIITEETGSAVEPSDEIKRASGDVQTMKISSVPNSLSKRNVSLTRSH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
ICH1210-50mg 50 mg
Anti-Mouse CD4 (YTS191) In Vivo Antibody - Low Endotoxin
Sign In for Pricing
View Details 
BNC040729-500 1x 500 µL
Ku-Holo (p70;83) (KU729), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
