Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALG1L2 Peptide - C-terminal region

ALG1L2 Peptide - C-terminal region

Product Specifications

UniProt

C9J202

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALG1L2 Rabbit Polyclonal Antibody (orb55729) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001129624.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FKEAPLDLQHRLFMKLGSTHSPFRARSEPEDPDTERSAFTERDSGSGLVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monolaurin
283608-01 250 g

Monolaurin

Sign In for Pricing
View Details
Monolaurin
283608-02 500 g

Monolaurin

Sign In for Pricing
View Details
TC2N Protein Vector (Rat) (pPM-C-His)
PV310073 500 ng

TC2N Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Ifng Antibody, HRP conjugated
CSB-PA15587B0Rb-01 50 µg

Ifng Antibody, HRP conjugated

Sign In for Pricing
View Details
Ifng Antibody, HRP conjugated
CSB-PA15587B0Rb-02 100 µg

Ifng Antibody, HRP conjugated

Sign In for Pricing
View Details
Lin-52 Antibody
orb800842 2 mg

Lin-52 Antibody

Sign In for Pricing
View Details