Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALG1L2 Peptide - C-terminal region

ALG1L2 Peptide - C-terminal region

Product Specifications

UniProt

C9J202

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALG1L2 Rabbit Polyclonal Antibody (orb55729) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001129624.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FKEAPLDLQHRLFMKLGSTHSPFRARSEPEDPDTERSAFTERDSGSGLVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDGFD (Platelet-derived Growth Factor D, PDGF-D, Iris-expressed Growth Factor, Spinal Cord-derived Growth Factor B, SCDGF-B, IEGF, SCDGFB, MSTP036, UNQ1899/PRO4345, MGC26867) (HRP)
131065-HRP 100 µL

PDGFD (Platelet-derived Growth Factor D, PDGF-D, Iris-expressed Growth Factor, Spinal Cord-derived Growth Factor B, SCDGF-B, IEGF, SCDGFB, MSTP036, UNQ1899/PRO4345, MGC26867) (HRP)

Sign In for Pricing
View Details
CD69 Polyclonal Antibody
JOT-AP01532-01 20 µL

CD69 Polyclonal Antibody

Sign In for Pricing
View Details
CD69 Polyclonal Antibody
JOT-AP01532-02 50 μL

CD69 Polyclonal Antibody

Sign In for Pricing
View Details
CD69 Polyclonal Antibody
JOT-AP01532-03 100 µL

CD69 Polyclonal Antibody

Sign In for Pricing
View Details
Lysosomal Acid Lipase (Cholesteryl Ester Hydrolase, Cholesteryl Esterase, Lipase A, Sterol Esterase, LIPA) (FITC)
227796 100 µg

Lysosomal Acid Lipase (Cholesteryl Ester Hydrolase, Cholesteryl Esterase, Lipase A, Sterol Esterase, LIPA) (FITC)

Sign In for Pricing
View Details
GPR75 Antibody
orb398032-01 50 μL

GPR75 Antibody

Sign In for Pricing
View Details