Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CENPT Peptide - C-terminal region

CENPT Peptide - C-terminal region

Product Specifications

Product Name Alternative

C16orf56, CENP-T

UniProt

Q96BT3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CENPT Rabbit Polyclonal Antibody (orb587335) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079358

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VRHPPRPRTTGPRPRQDPHKAGLSHYVKLFSFYAKMPMERKALEMVEKCL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PREI3 (MOB4) (NM_015387) Human Over-expression Lysate
LC402432 20 µg

PREI3 (MOB4) (NM_015387) Human Over-expression Lysate

Sign In for Pricing
View Details
Chloromethyl Polystyrene
H40001.25G 25 g

Chloromethyl Polystyrene

Sign In for Pricing
View Details
Recombinant MRC1 Antibody
RC-4992-01 50 μL

Recombinant MRC1 Antibody

Sign In for Pricing
View Details
Recombinant MRC1 Antibody
RC-4992-02 100 µL

Recombinant MRC1 Antibody

Sign In for Pricing
View Details
Recombinant MRC1 Antibody
RC-4992-03 1 mL

Recombinant MRC1 Antibody

Sign In for Pricing
View Details
Ginkgolide C
TRC-G387435-25MG 25 mg

Ginkgolide C

Sign In for Pricing
View Details