Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNOT10 Peptide - C-terminal region

CNOT10 Peptide - C-terminal region

Product Specifications

UniProt

Q9H9A5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CNOT10 Rabbit Polyclonal Antibody (orb326955) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NVTDVSLGISSNEQDQGSDKGENEAMESSGKRAPQCYPSSVNSARTVMLF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Peroxisome Proliferator Activated Receptor Gamma (PPARg) CLIA Kit
abx492185-01 96 Tests

Rat Peroxisome Proliferator Activated Receptor Gamma (PPARg) CLIA Kit

Sign In for Pricing
View Details
Rat Peroxisome Proliferator Activated Receptor Gamma (PPARg) CLIA Kit
abx492185-02 5x 96 Tests

Rat Peroxisome Proliferator Activated Receptor Gamma (PPARg) CLIA Kit

Sign In for Pricing
View Details
Rat Peroxisome Proliferator Activated Receptor Gamma (PPARg) CLIA Kit
abx492185-03 10x 96 Tests

Rat Peroxisome Proliferator Activated Receptor Gamma (PPARg) CLIA Kit

Sign In for Pricing
View Details
Glutamate Receptor Ionotropic, NMDA 2B (GluN2B) Antibody (HRP)
abx443505 100 µg

Glutamate Receptor Ionotropic, NMDA 2B (GluN2B) Antibody (HRP)

Sign In for Pricing
View Details
SLC4A3 Protein Vector (Rat) (pPM-C-His)
PV306237 500 ng

SLC4A3 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Human ADAMTS8 knockout cell line
ABC-KH0276 1 Vial

Human ADAMTS8 knockout cell line

Sign In for Pricing
View Details