Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COPZ1 Peptide - middle region

COPZ1 Peptide - middle region

Product Specifications

UniProt

F8VVA7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COPZ1 Rabbit Polyclonal Antibody (orb587339) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2310002L09Rik Mouse shRNA Plasmid (Locus ID 71886)
TR509171 1 Kit

2310002L09Rik Mouse shRNA Plasmid (Locus ID 71886)

Sign In for Pricing
View Details
Apol9b ORF Vector (Mouse) (pORF)
ORF038843 1.0 µg DNA

Apol9b ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Chicken 1 acyl sn glycerol 3 phosphate acyltransferase gamma (AGPAT3) ELISA kit
GTR10412149 96 Well

Chicken 1 acyl sn glycerol 3 phosphate acyltransferase gamma (AGPAT3) ELISA kit

Sign In for Pricing
View Details
Rab5 Rabbit mAb
F0259-100uL*2 2x 100 μL

Rab5 Rabbit mAb

Sign In for Pricing
View Details
BTK Antibody Blocking peptide
orb1446060 500 µg

BTK Antibody Blocking peptide

Sign In for Pricing
View Details
GIPC2 Antibody
K40029M11A02C-01 50 ug

GIPC2 Antibody

Sign In for Pricing
View Details