Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COPZ1 Peptide - middle region

COPZ1 Peptide - middle region

Product Specifications

UniProt

F8VVA7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COPZ1 Rabbit Polyclonal Antibody (orb587339) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Psoracorylifol C
HY-N10820 1 Each

Psoracorylifol C

Sign In for Pricing
View Details
GGPS1 Rabbit pAb
MBS9142232-01 0.02 mL

GGPS1 Rabbit pAb

Sign In for Pricing
View Details
GGPS1 Rabbit pAb
MBS9142232-02 0.1 mL

GGPS1 Rabbit pAb

Sign In for Pricing
View Details
GGPS1 Rabbit pAb
MBS9142232-03 5x 0.1 mL

GGPS1 Rabbit pAb

Sign In for Pricing
View Details
CRAMP1L (CRAMP1) Human shRNA Lentiviral Particle (Locus ID 57585)
TL305230V 500 µL Each

CRAMP1L (CRAMP1) Human shRNA Lentiviral Particle (Locus ID 57585)

Sign In for Pricing
View Details
Deep freezer
E3826 1 Unit

Deep freezer

Sign In for Pricing
View Details