CSRNP2 Peptide - C-terminal region
CSRNP2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
C12orf2, C12orf22, FAM130A1, PPP1R72, TAIP-12
UniProt
Q9H175
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CSRNP2 Rabbit Polyclonal Antibody (orb587342) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_110436
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EPENEDFHPSWSPSSLPFRTDNEEGCGMVKTSQQNEDRPPEDSSLELPLA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6394103-01 0.1 mL
SH2D3C (SH2 Domain-Containing Protein 3C, Novel SH2-Containing Protein 3, NSP3, UNQ272/PRO309/PRO34088) APC
Sign In for Pricing
View Details MBS6394103-02 5x 0.1 mL
SH2D3C (SH2 Domain-Containing Protein 3C, Novel SH2-Containing Protein 3, NSP3, UNQ272/PRO309/PRO34088) APC
Sign In for Pricing
View Details