Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSRNP2 Peptide - C-terminal region

CSRNP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C12orf2, C12orf22, FAM130A1, PPP1R72, TAIP-12

UniProt

Q9H175

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CSRNP2 Rabbit Polyclonal Antibody (orb587342) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_110436

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EPENEDFHPSWSPSSLPFRTDNEEGCGMVKTSQQNEDRPPEDSSLELPLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tropomyosin Rabbit Polyclonal Antibody (BF680)
orb2374714 100 µL

Tropomyosin Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
Recombinant mouse Membrane cofactor protein
MBS9420089-01 0.02 mg

Recombinant mouse Membrane cofactor protein

Sign In for Pricing
View Details
Recombinant mouse Membrane cofactor protein
MBS9420089-02 0.1 mg

Recombinant mouse Membrane cofactor protein

Sign In for Pricing
View Details
Recombinant mouse Membrane cofactor protein
MBS9420089-03 1 mg

Recombinant mouse Membrane cofactor protein

Sign In for Pricing
View Details
Recombinant mouse Membrane cofactor protein
MBS9420089-04 5x 1 mg

Recombinant mouse Membrane cofactor protein

Sign In for Pricing
View Details
Cyantraniliprole
B1648-5 5 mg

Cyantraniliprole

Sign In for Pricing
View Details