CWF19L1 Peptide - N-terminal region
CWF19L1 Peptide - N-terminal region
Product Specifications
UniProt
D3DR67
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CWF19L1 Rabbit Polyclonal Antibody (orb587348) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ENPYRKSGQEASIGKQILAPVEESACQFFFDLNEKQGRKRSSTGRDSKSS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![ZNF454 Mouse Monoclonal Antibody [Clone ID: OTI7C4]](https://cdn.genprice.uk/products/937/68dd18bb061270361e908a0f/imageurl/cf811041.webp)
CF811041 100 µg
ZNF454 Mouse Monoclonal Antibody [Clone ID: OTI7C4]
Sign In for Pricing
View Details 
BNUB2385-500 1x 500 µL
CD14 (Monocyte / Macrophage Marker) (LPSR/2385), 0.2mg/mL
Sign In for Pricing
View Details 