Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CWF19L1 Peptide - N-terminal region

CWF19L1 Peptide - N-terminal region

Product Specifications

UniProt

D3DR67

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CWF19L1 Rabbit Polyclonal Antibody (orb587348) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ENPYRKSGQEASIGKQILAPVEESACQFFFDLNEKQGRKRSSTGRDSKSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RAMP1 activation kit by CRISPRa
GA106991 1 Kit

Human RAMP1 activation kit by CRISPRa

Sign In for Pricing
View Details
RBFOX2 (NM_001031695) Human Over-expression Lysate
LY421906 100 µg

RBFOX2 (NM_001031695) Human Over-expression Lysate

Sign In for Pricing
View Details
Chromogranin A (CHGA) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B8]
TA506096AM 100 µL

Chromogranin A (CHGA) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B8]

Sign In for Pricing
View Details
17Alpha-Acetoxy Pregnenolone
TRC-A167680-1G 1 g

17Alpha-Acetoxy Pregnenolone

Sign In for Pricing
View Details
3Alpha,12-Alpha-Dihydroxy-7-diazirdinecholanic Acid
TRC-D452720-50MG 50 mg

3Alpha,12-Alpha-Dihydroxy-7-diazirdinecholanic Acid

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF740 conjugate, 0.1mg/mL
BNC740181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details