METTL17 Peptide - C-terminal region
METTL17 Peptide - C-terminal region
Product Specifications
Product Name Alternative
METT11D1
UniProt
Q9H7H0
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with METTL17 Rabbit Polyclonal Antibody (orb587532) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_073571
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GVFFRQFLPVSPKVQFDVVVSAFSLSELPSKADRTEVVQTLWRKTGHFLV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC043006-500 1x 500 µL
VISTA / GI24 (Negative Regulator of Immune Response) (VISTA/3006), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
GM-40-40 1 mL
Colloidal Gold Conjugated Monoclonal Antibody to Human Lambda, 40nm
Sign In for Pricing
View Details 
BNC472949-500 1x 500 µL
Fibronectin (FN1/2949), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LC401922 20 µg
PHAPI2 / APRIL (ANP32B) (NM_006401) Human Over-expression Lysate
Sign In for Pricing
View Details 