Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS5 Peptide - N-terminal region

MRPS5 Peptide - N-terminal region

Product Specifications

UniProt

P82675

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPS5 Rabbit Polyclonal Antibody (orb587543) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KRKDLNRGQIIGEGRYGFLWPGLNVPLMKNGAVQTIAQRSKEEQEKVEAD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Colon
CR561370 5 µg

Tissue Total RNA, Colon

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS708982 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
Human LDLRAD2 activation kit by CRISPRa
GA118351 1 Kit

Human LDLRAD2 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Ileum
CS709099 5x 5 µm

Tissue FFPE Sections, Ileum

Sign In for Pricing
View Details
Cytokeratin 18 (DE-K18), Biotin conjugate, 0.1mg/mL
BNCB0563-100 1x 100 µL

Cytokeratin 18 (DE-K18), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRBP (TARBP2) Mouse Monoclonal Antibody [Clone ID: OTI7C1]
CF808481 100 µg

TRBP (TARBP2) Mouse Monoclonal Antibody [Clone ID: OTI7C1]

Sign In for Pricing
View Details