Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

N4BP2L1 Peptide - C-terminal region

N4BP2L1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CG018

UniProt

Q5TBK1

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with N4BP2L1 Rabbit Polyclonal Antibody (orb327031) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_438169

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GVSREKIHRMKERYEHDVTFHSVLHAEKPSRMNRNQDRNNALPSNNARYW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEMCAP3 (PDZRN3) (NM_001303141) Human Tagged ORF Clone
RG239564 10 µg

SEMCAP3 (PDZRN3) (NM_001303141) Human Tagged ORF Clone

Sign In for Pricing
View Details
SOX2 (Transcription Factor) (SOX2/1791), CF740 conjugate, 0.1mg/mL
BNC741791-100 1x 100 µL

SOX2 (Transcription Factor) (SOX2/1791), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Mouse IL13RA1 Protein (His Tag)
PKSM040873 50 µg

Recombinant Mouse IL13RA1 Protein (His Tag)

Sign In for Pricing
View Details
STAT6 Rabbit Polyclonal Antibody
AP02592PU-N 100 µL

STAT6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
VAMP8 Rabbit Polyclonal Antibody
TA383191 100 µL

VAMP8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bisphenol F-d10
TRC-B519557-1MG 1 mg

Bisphenol F-d10

Sign In for Pricing
View Details