N4BP2L1 Peptide - C-terminal region
N4BP2L1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
CG018
UniProt
Q5TBK1
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with N4BP2L1 Rabbit Polyclonal Antibody (orb327031) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_438169
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GVSREKIHRMKERYEHDVTFHSVLHAEKPSRMNRNQDRNNALPSNNARYW
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC682552-500 1x 500 µL
AKT1 (Prognostic Marker for Neuroendocrine Tumors) (AKT1/2552), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC473019-500 1x 500 µL
CD47 / IAP (Integrin Associated Protein) (CD47/3019), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
AP52635PU-N 400 µL
MCHR (MCHR1) (C-term) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details