Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR1J4 Peptide - C-terminal region

OR1J4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HSHTPCRX01, HTPCRX01, OR9-21

UniProt

Q8NGS1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR1J4 Rabbit Polyclonal Antibody (orb587578) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004452

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALSTCGSHLSVVSLYYGTIIGLYFLPSSSASSDKDVIASVMYTVITPLLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Nfya activation kit by CRISPRa
GA202892 1 Kit

Mouse Nfya activation kit by CRISPRa

Sign In for Pricing
View Details
SLC13A2 (NM_001145975) Human Over-expression Lysate
LC431542 20 µg

SLC13A2 (NM_001145975) Human Over-expression Lysate

Sign In for Pricing
View Details
PR 619
TRC-P699010-25MG 25 mg

PR 619

Sign In for Pricing
View Details
EMX1 (NM_004097) Human Over-expression Lysate
LY418217 100 µg

EMX1 (NM_004097) Human Over-expression Lysate

Sign In for Pricing
View Details
CD13 Antibody
KC-988-01 50 μL

CD13 Antibody

Sign In for Pricing
View Details
CD13 Antibody
KC-988-02 100 µL

CD13 Antibody

Sign In for Pricing
View Details