Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF213 Peptide - N-terminal region

RNF213 Peptide - N-terminal region

Product Specifications

UniProt

Q63HN8

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RNF213 Rabbit Polyclonal Antibody (orb580163) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_066005

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ETGNNSVQTVFQGTLAATKRWLREVFTKNMLTSSGASFTYVKEIEVWRRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smad1 Mouse shRNA Lentiviral Particle (Locus ID 17125)
TL509527V 500 µL Each

Smad1 Mouse shRNA Lentiviral Particle (Locus ID 17125)

Sign In for Pricing
View Details
MS4A15 (NM_001098835) Human Tagged ORF Clone Lentiviral Particle
RC213714L3V 200 µL

MS4A15 (NM_001098835) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
GJB6 Polyclonal Antibody
A59238-020 20 µL

GJB6 Polyclonal Antibody

Sign In for Pricing
View Details
3'-hydroxy-3,4,5'-trimethoxybibenzyl
TN8539-01 10 mg

3'-hydroxy-3,4,5'-trimethoxybibenzyl

Sign In for Pricing
View Details
3'-hydroxy-3,4,5'-trimethoxybibenzyl
TN8539-02 50 mg

3'-hydroxy-3,4,5'-trimethoxybibenzyl

Sign In for Pricing
View Details
Brain Heart Infusion Broth 200 mL (Culture media in glass tubes/bottles)
412010 6/Pack

Brain Heart Infusion Broth 200 mL (Culture media in glass tubes/bottles)

Sign In for Pricing
View Details