Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF213 Peptide - N-terminal region

RNF213 Peptide - N-terminal region

Product Specifications

UniProt

Q63HN8

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RNF213 Rabbit Polyclonal Antibody (orb580163) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_066005

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ETGNNSVQTVFQGTLAATKRWLREVFTKNMLTSSGASFTYVKEIEVWRRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chlamydia pneumoniae COMC Antigen
BA1371VS 1mg

Chlamydia pneumoniae COMC Antigen

Sign In for Pricing
View Details
Rabbit Polyclonal SART1 Antibody [PerCP]
NBP2-14836PCP 0.1 mL

Rabbit Polyclonal SART1 Antibody [PerCP]

Sign In for Pricing
View Details
Tyrosine Hydroxylase (TH) Rabbit Polyclonal Antibody
TA325937 100 µL

Tyrosine Hydroxylase (TH) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PDCD10 Antibody
A66592-100UG 100 µg

PDCD10 Antibody

Sign In for Pricing
View Details
Butyl (2-chloro-6-fluoro-3-methylphenyl) sulfane
PC1020548-01 250 mg

Butyl (2-chloro-6-fluoro-3-methylphenyl) sulfane

Sign In for Pricing
View Details
Butyl (2-chloro-6-fluoro-3-methylphenyl) sulfane
PC1020548-02 500 mg

Butyl (2-chloro-6-fluoro-3-methylphenyl) sulfane

Sign In for Pricing
View Details