Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NEK2 Peptide - N-terminal region

NEK2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HsPK21, NEK2A, NLK1

UniProt

P51955

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NEK2 Rabbit Polyclonal Antibody (orb580456) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002488

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RSDGGHTVLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFAKTFVGT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C19orf51 (DNAAF3) (NM_178837) Human 3' UTR Clone
SC205939 10 µg

C19orf51 (DNAAF3) (NM_178837) Human 3' UTR Clone

Sign In for Pricing
View Details
HRH1 Rabbit Polyclonal Antibody
TA371375 100 µL

HRH1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IL3 Human Recombinant Protein
TP727997 10 µg

IL3 Human Recombinant Protein

Sign In for Pricing
View Details
Phospho-FLNC (Ser2233) Rabbit Polyclonal Antibody (Biotin)
orb501981 100 µL

Phospho-FLNC (Ser2233) Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Olfr642 Protein Vector (Mouse) (pPM-C-HA)
33326024 500 ng

Olfr642 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Fmoc-L-Thr(beta-D-Gal(Ac)4)-OH
MBS9023068-01 1 g

Fmoc-L-Thr(beta-D-Gal(Ac)4)-OH

Sign In for Pricing
View Details