Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NEK2 Peptide - N-terminal region

NEK2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HsPK21, NEK2A, NLK1

UniProt

P51955

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NEK2 Rabbit Polyclonal Antibody (orb580456) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002488

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RSDGGHTVLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFAKTFVGT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Syntrophin alpha 1 Rabbit Monoclonal Antibody
E10G22067 100 µL

Syntrophin alpha 1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
DCTN4 Protein Vector (Human) (pPB-N-His)
PV011818 500 ng

DCTN4 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
PSG3 discontinued
541353-01 30ul

PSG3 discontinued

Sign In for Pricing
View Details
PSG3 discontinued
541353-02 100 µL

PSG3 discontinued

Sign In for Pricing
View Details
ZAC/Plagl1 Rabbit Polyclonal Antibody (Fluoro647)
orb3108435 100 µg

ZAC/Plagl1 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
IFN-α6 CRISPR Activation Plasmid (h2)
sc-417075-ACT-2 20 µg

IFN-α6 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details