Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALG1 Peptide - C-terminal region

ALG1 Peptide - C-terminal region

Product Specifications

UniProt

B4DP08

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALG1 Rabbit Polyclonal Antibody (orb580684) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VKHEENGLVFEDSEELAAQLQMLFSNFPDPAGKLNQFRKNLRESQQLRWD

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse LECT1 (Leukocyte Cell Derived Chemotaxin 1) ELISA Kit
EM23781 96 Tests

Mouse LECT1 (Leukocyte Cell Derived Chemotaxin 1) ELISA Kit

Sign In for Pricing
View Details
STFR E007-148x210-AL-CRD/1 AC Signs
814954 Card of 1 Pictogram(s)

STFR E007-148x210-AL-CRD/1 AC Signs

Sign In for Pricing
View Details
Nrbp1 (NM_147201) Mouse Recombinant Protein
E45M45782M5 20 µg

Nrbp1 (NM_147201) Mouse Recombinant Protein

Sign In for Pricing
View Details
MAP3K9 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-10424R-BF488-TR 20 µL

MAP3K9 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
BVES Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV696838 1.0 µg DNA

BVES Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
GENLISA™ Mouse Klotho Beta (KLb) ELISA
KLM1880 1x 96 Well

GENLISA™ Mouse Klotho Beta (KLb) ELISA

Sign In for Pricing
View Details