Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALG1 Peptide - C-terminal region

ALG1 Peptide - C-terminal region

Product Specifications

UniProt

B4DP08

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALG1 Rabbit Polyclonal Antibody (orb580684) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VKHEENGLVFEDSEELAAQLQMLFSNFPDPAGKLNQFRKNLRESQQLRWD

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-4714-5p miRNA Mimic
orb1877199-01 5 nmol

Hsa-miR-4714-5p miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-4714-5p miRNA Mimic
orb1877199-02 10 nmol

Hsa-miR-4714-5p miRNA Mimic

Sign In for Pricing
View Details
Mouse PP (Pancreatic Polypeptide) ELISA Kit
MBS8802028-01 48 Strip Well

Mouse PP (Pancreatic Polypeptide) ELISA Kit

Sign In for Pricing
View Details
Mouse PP (Pancreatic Polypeptide) ELISA Kit
MBS8802028-02 96 Strip Well

Mouse PP (Pancreatic Polypeptide) ELISA Kit

Sign In for Pricing
View Details
Mouse PP (Pancreatic Polypeptide) ELISA Kit
MBS8802028-03 5x 96 Strip Well

Mouse PP (Pancreatic Polypeptide) ELISA Kit

Sign In for Pricing
View Details
Mouse PP (Pancreatic Polypeptide) ELISA Kit
MBS8802028-04 10x 96 Strip Well

Mouse PP (Pancreatic Polypeptide) ELISA Kit

Sign In for Pricing
View Details