Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LMF1 Peptide - N-terminal region

LMF1 Peptide - N-terminal region

Product Specifications

UniProt

H3BVI4

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LMF1 Rabbit Polyclonal Antibody (orb580846) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LNWLTMVPSLACFDDATLGFLFPSGPGSLKDRVLQMQRDIRGARPEPRFG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2M Rabbit Polyclonal Antibody
TA356299 100 µL

UBE2M Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BCL9 (B Cell CLL/Lymphoma 9 Protein, B Cell Lymphoma 9 Protein, Bcl-9, Protein Legless Homolog) APC
MBS6135510-01 0.1 mL

BCL9 (B Cell CLL/Lymphoma 9 Protein, B Cell Lymphoma 9 Protein, Bcl-9, Protein Legless Homolog) APC

Sign In for Pricing
View Details
BCL9 (B Cell CLL/Lymphoma 9 Protein, B Cell Lymphoma 9 Protein, Bcl-9, Protein Legless Homolog) APC
MBS6135510-02 5x 0.1 mL

BCL9 (B Cell CLL/Lymphoma 9 Protein, B Cell Lymphoma 9 Protein, Bcl-9, Protein Legless Homolog) APC

Sign In for Pricing
View Details
Mouse Monoclonal ACTH Antibody (CLIP/1407) [DyLight 680]
NBP2-47683FR 0.1 mL

Mouse Monoclonal ACTH Antibody (CLIP/1407) [DyLight 680]

Sign In for Pricing
View Details
Furan-2-carboxylic acid (4-amino-2-chloro-phenyl) -amide
sc-327859 500 mg

Furan-2-carboxylic acid (4-amino-2-chloro-phenyl) -amide

Sign In for Pricing
View Details
RRM1 Rabbit mAb
F0909-100ul 100 µL

RRM1 Rabbit mAb

Sign In for Pricing
View Details