Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PEG10 Peptide - N-terminal region

PEG10 Peptide - N-terminal region

Product Specifications

Product Name Alternative

EDR, HB-1, MEF3L, Mar2, Mart2, RGAG3

UniProt

Q86TG7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PEG10 Rabbit Polyclonal Antibody (orb581340) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055883

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SMMTGRAARWASAKLERSHYLMHNYPAFMMEMKHVFEDPQRREVAKRKIR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GABPB2 (NM_144618) Human Tagged Lenti ORF Clone
RC205763L3 10 µg

GABPB2 (NM_144618) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Phospho-RIP (Ser166) Rabbit mAb
C05216-100uL 100 µL

Phospho-RIP (Ser166) Rabbit mAb

Sign In for Pricing
View Details
Rabbit Anti-Human TCP1 beta mAb
MA1086-01 50 μL

Rabbit Anti-Human TCP1 beta mAb

Sign In for Pricing
View Details
Rabbit Anti-Human TCP1 beta mAb
MA1086-02 100 μL

Rabbit Anti-Human TCP1 beta mAb

Sign In for Pricing
View Details
Taf4 Mouse shRNA Lentiviral Particle (Locus ID 228980)
TL517841V 500 µL Each

Taf4 Mouse shRNA Lentiviral Particle (Locus ID 228980)

Sign In for Pricing
View Details
HoxD9 (h) : 293T Lysate
sc-115615 100 µg - 200 µL

HoxD9 (h) : 293T Lysate

Sign In for Pricing
View Details