Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PEG10 Peptide - N-terminal region

PEG10 Peptide - N-terminal region

Product Specifications

Product Name Alternative

EDR, HB-1, MEF3L, Mar2, Mart2, RGAG3

UniProt

Q86TG7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PEG10 Rabbit Polyclonal Antibody (orb581340) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055883

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SMMTGRAARWASAKLERSHYLMHNYPAFMMEMKHVFEDPQRREVAKRKIR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MDFI CRISPRa sgRNA lentivector (set of three targets)(Rat)
28260126 3x 1.0µg DNA

MDFI CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Rat ovarian cancer marker-CA125 ELISA Kit
SL0552Ra-01 48 Tests

Rat ovarian cancer marker-CA125 ELISA Kit

Sign In for Pricing
View Details
Rat ovarian cancer marker-CA125 ELISA Kit
SL0552Ra-02 96 Tests

Rat ovarian cancer marker-CA125 ELISA Kit

Sign In for Pricing
View Details
Recombinant Nicotiana plumbaginifolia Chlorophyll a-b binding protein C, chloroplastic (CABC)
MBS1187920 Inquire

Recombinant Nicotiana plumbaginifolia Chlorophyll a-b binding protein C, chloroplastic (CABC)

Sign In for Pricing
View Details
RPL12P19 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV776378 1.0 µg DNA

RPL12P19 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
HMGCR Protein Vector (Rat) (pPM-C-HA)
23583026 500 ng

HMGCR Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details