SPAG11B Peptide - N-terminal region
SPAG11B Peptide - N-terminal region
Product Specifications
UniProt
Q08648
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SPAG11B Rabbit Polyclonal Antibody (orb582193) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_478114
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VALLFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKRDLLP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Phospho-Tau (S396) Recombinant Rabbit monoclonal Antibody [SN62-09]](https://cdn.genprice.uk/products/992/68dd1c8c061270361ea81a1b/imageurl/et1611-68-50ul.webp)
ET1611-68-50UL 50 µL
Phospho-Tau (S396) Recombinant Rabbit monoclonal Antibody [SN62-09]
Sign In for Pricing
View Details 
LY403350 100 µg
ROR alpha (RORA) (NM_134261) Human Over-expression Lysate
Sign In for Pricing
View Details