SPAG11B Peptide - N-terminal region
SPAG11B Peptide - N-terminal region
Product Specifications
UniProt
Q08648
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SPAG11B Rabbit Polyclonal Antibody (orb582193) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_478114
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VALLFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKRDLLP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC742889-500 1x 500 µL
Secretory Component / ECM1 (ECM1/2889R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881948-500 1x 500 µL
Cytokeratin 10 (Suprabasal Epithelial Marker) (KRT10/1948R), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![Cytochrome P450 17A1 (CYP17A1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5G10]](https://cdn.genprice.uk/products/937/68dd1b6b061270361ea166d5/imageurl/ta503415am.webp)
TA503415AM 100 µL
Cytochrome P450 17A1 (CYP17A1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5G10]
Sign In for Pricing
View Details 