EYA3 Peptide - middle region
EYA3 Peptide - middle region
Product Specifications
UniProt
Q99504
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EYA3 Rabbit Polyclonal Antibody (orb583810) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001981
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YQSEKPSVMAPAPAAQRLSSGDPSTSPSLSQTTPSKDTDDQSRKNMTSKN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7037936-01 0.02 mg
Recombinant Hepatitis B virus genotype C subtype adr Large envelope protein (S)
Sign In for Pricing
View Details MBS7037936-02 0.1 mg
Recombinant Hepatitis B virus genotype C subtype adr Large envelope protein (S)
Sign In for Pricing
View Details MBS7037936-03 5x 0.1 mg
Recombinant Hepatitis B virus genotype C subtype adr Large envelope protein (S)
Sign In for Pricing
View Details 