Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RORC Peptide - N-terminal region

RORC Peptide - N-terminal region

Product Specifications

Product Name Alternative

NR1F3, RORG, RZR-GAMMA, RZRG, TOR

UniProt

Q6I9R9

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RORC Rabbit Polyclonal Antibody (orb330960) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005051

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPN (Structural Protein-Nucleocapsid) discontinued
544115 100 µg

SPN (Structural Protein-Nucleocapsid) discontinued

Sign In for Pricing
View Details
Anti-CHMP6 Antibody
CQA6979-01 30 µL

Anti-CHMP6 Antibody

Sign In for Pricing
View Details
Anti-CHMP6 Antibody
CQA6979-02 50 μL

Anti-CHMP6 Antibody

Sign In for Pricing
View Details
Anti-CHMP6 Antibody
CQA6979-03 100 µL

Anti-CHMP6 Antibody

Sign In for Pricing
View Details
Anti-CHMP6 Antibody
CQA6979-04 200 µL

Anti-CHMP6 Antibody

Sign In for Pricing
View Details
Lentiviral mouse Gatad1 shRNA (UAS) - Lentiviral mouse Gatad1 shRNA (UAS, iRFP) (25)
GTR15278078 1 Vial

Lentiviral mouse Gatad1 shRNA (UAS) - Lentiviral mouse Gatad1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details