Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RORC Peptide - N-terminal region

RORC Peptide - N-terminal region

Product Specifications

Product Name Alternative

NR1F3, RORG, RZR-GAMMA, RZRG, TOR

UniProt

Q6I9R9

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RORC Rabbit Polyclonal Antibody (orb330960) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005051

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1- (cyclopentylcarbonyl) pyrrolidine-2-carboxylic acid
sc-333145 1 g

1- (cyclopentylcarbonyl) pyrrolidine-2-carboxylic acid

Sign In for Pricing
View Details
BRCA1 (NM_007294) Human Mutant ORF Clone
RC402816 10 µg

BRCA1 (NM_007294) Human Mutant ORF Clone

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) HSFA2 Polyclonal Antibody
MBS7182904 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) HSFA2 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Haemophilus Influenzae tdk Protein (aa 1-193) (strain 86-028NP)
VAng-Lsx03893-50gEcoli 50 µg (E. coli)

Recombinant Haemophilus Influenzae tdk Protein (aa 1-193) (strain 86-028NP)

Sign In for Pricing
View Details
SS18 Protein Vector (Mouse) (pPB-C-His)
PV234098 500 ng

SS18 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
SEC23 Recombinant Antibody, APC Conjugated
bsm-61742R-APC-TR 20 µL

SEC23 Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details