HDDC2 Peptide - N-terminal region
HDDC2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
C6orf74, NS5ATP2, dJ167O5.2
UniProt
Q7Z4H3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HDDC2 Rabbit Polyclonal Antibody (orb584068) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_057147
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ASVSSATFSGHGARSLLQFLRLVGQLKRVPRTGWVYRNVQRPESVSDHMY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP17551PU-N 400 µL
EMAP II (AIMP1) (C-term) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
BNC883241-500 1x 500 µL
Dystrophin (DMD) (Marker of Duchenne and Becker Muscular Dystrophy) (DMD/3241), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
