Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HDDC2 Peptide - N-terminal region

HDDC2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C6orf74, NS5ATP2, dJ167O5.2

UniProt

Q7Z4H3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HDDC2 Rabbit Polyclonal Antibody (orb584068) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057147

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ASVSSATFSGHGARSLLQFLRLVGQLKRVPRTGWVYRNVQRPESVSDHMY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

cis-Octahydropyrrolo[3,4-b]pyridine
TRC-O236960-250MG 250 mg

cis-Octahydropyrrolo[3,4-b]pyridine

Sign In for Pricing
View Details
Avpr1a Mouse Gene Knockout Kit (CRISPR)
KN501881 1 Kit

Avpr1a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD11a / ITGAL Mouse Monoclonal Antibody [Clone ID: 8-6.2]
CL013FX 300 µg

CD11a / ITGAL Mouse Monoclonal Antibody [Clone ID: 8-6.2]

Sign In for Pricing
View Details
L-Alanyl-L-1-aminoethylphosphonic Acid
TRC-A511353-50MG 50 mg

L-Alanyl-L-1-aminoethylphosphonic Acid

Sign In for Pricing
View Details
Stackable 300?l tip box BPIC-708
BPIC-708 1 Unit

Stackable 300?l tip box BPIC-708

Sign In for Pricing
View Details
3,5-Difluoro-L-phenylalanine
TRC-D451205-250MG 250 mg

3,5-Difluoro-L-phenylalanine

Sign In for Pricing
View Details