LSM3, Human (His)
The LSM3 protein plays a crucial role in pre-mRNA splicing as a component of the U4/U6-U5 tri-snRNP complex involved in spliceosome assembly and as part of the precatalytic spliceosome (spliceosome B complex) . The heptameric LSM2-8 complex (including LSM3) specifically binds to the 3'-end U strand of U6 snRNA. LSM3 Protein, Human (His) is the recombinant human-derived LSM3 protein, expressed by E. coli , with N-His labeled tag.
Product Specifications
Product Name Alternative
LSM3 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/lsm3-protein-human-his.html
Purity
98.0
Smiles
MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG
Molecular Formula
27258 (Gene_ID) P62310 /NP_055278.1 (M1-G102) (Accession)
Molecular Weight
Approximately 16 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
APC-Linked Polyclonal Antibody to Cytochrome P450 27B1 (CYP27B1)
APC-Linked Polyclonal Antibody to Cytochrome P450 27B1 (CYP27B1)
APC-Linked Polyclonal Antibody to Cytochrome P450 27B1 (CYP27B1)
APC-Linked Polyclonal Antibody to Cytochrome P450 27B1 (CYP27B1)
APC-Linked Polyclonal Antibody to Cytochrome P450 27B1 (CYP27B1)