Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LSM3, Human (His)

The LSM3 protein plays a crucial role in pre-mRNA splicing as a component of the U4/U6-U5 tri-snRNP complex involved in spliceosome assembly and as part of the precatalytic spliceosome (spliceosome B complex) . The heptameric LSM2-8 complex (including LSM3) specifically binds to the 3'-end U strand of U6 snRNA. LSM3 Protein, Human (His) is the recombinant human-derived LSM3 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

LSM3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lsm3-protein-human-his.html

Purity

98.0

Smiles

MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG

Molecular Formula

27258 (Gene_ID) P62310 /NP_055278.1 (M1-G102) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Streptomyces avermitilis Phosphoribosyl-ATP pyrophosphatase (hisE)
MBS1467333-01 0.02 mg (E-Coli)

Recombinant Streptomyces avermitilis Phosphoribosyl-ATP pyrophosphatase (hisE)

Sign In for Pricing
View Details
Recombinant Streptomyces avermitilis Phosphoribosyl-ATP pyrophosphatase (hisE)
MBS1467333-02 0.1 mg (E-Coli)

Recombinant Streptomyces avermitilis Phosphoribosyl-ATP pyrophosphatase (hisE)

Sign In for Pricing
View Details
Recombinant Streptomyces avermitilis Phosphoribosyl-ATP pyrophosphatase (hisE)
MBS1467333-03 0.02 mg (Yeast)

Recombinant Streptomyces avermitilis Phosphoribosyl-ATP pyrophosphatase (hisE)

Sign In for Pricing
View Details
Recombinant Streptomyces avermitilis Phosphoribosyl-ATP pyrophosphatase (hisE)
MBS1467333-04 0.1 mg (Yeast)

Recombinant Streptomyces avermitilis Phosphoribosyl-ATP pyrophosphatase (hisE)

Sign In for Pricing
View Details
Recombinant Streptomyces avermitilis Phosphoribosyl-ATP pyrophosphatase (hisE)
MBS1467333-05 0.02 mg (Baculovirus)

Recombinant Streptomyces avermitilis Phosphoribosyl-ATP pyrophosphatase (hisE)

Sign In for Pricing
View Details
Recombinant Streptomyces avermitilis Phosphoribosyl-ATP pyrophosphatase (hisE)
MBS1467333-06 1 mg (E-Coli)

Recombinant Streptomyces avermitilis Phosphoribosyl-ATP pyrophosphatase (hisE)

Sign In for Pricing
View Details