Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RADIL Peptide - C-terminal region

RADIL Peptide - C-terminal region

Product Specifications

Product Name Alternative

RASIP2

UniProt

Q96JH8

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RADIL Rabbit Polyclonal Antibody (orb585724) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060529

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LGDRILEVNGSSLLGLGYLRAVDLIRHGGKKMRFLVAKSDVETAKKIHFR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Naphthaldehyde
TRC-N344800-5G 5 g

1-Naphthaldehyde

Sign In for Pricing
View Details
Glucosidase 2 subunit beta (PRKCSH) Rabbit Polyclonal Antibody
TA370898 100 µL

Glucosidase 2 subunit beta (PRKCSH) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AMCA acid *CAS#: 106562-32-7*
501-AAT 25 mg

AMCA acid *CAS#: 106562-32-7*

Sign In for Pricing
View Details
DIR (DIIC18 (7) ), 5x1mg
#60017-5mg 5x 1 mg

DIR (DIIC18 (7) ), 5x1mg

Sign In for Pricing
View Details
ZNF707 (NM_001100599) Human Over-expression Lysate
LC420277 20 µg

ZNF707 (NM_001100599) Human Over-expression Lysate

Sign In for Pricing
View Details
CLEC2L (N-term) Rabbit Polyclonal Antibody
AP50961PU-N 400 µL

CLEC2L (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details