Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RADIL Peptide - C-terminal region

RADIL Peptide - C-terminal region

Product Specifications

Product Name Alternative

RASIP2

UniProt

Q96JH8

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RADIL Rabbit Polyclonal Antibody (orb585724) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060529

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LGDRILEVNGSSLLGLGYLRAVDLIRHGGKKMRFLVAKSDVETAKKIHFR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tcf25 Mouse Gene Knockout Kit (CRISPR)
KN517324 1 Kit

Tcf25 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human BCCIP activation kit by CRISPRa
GA111202 1 Kit

Human BCCIP activation kit by CRISPRa

Sign In for Pricing
View Details
CLDN3 Antibody
KC-2308-01 50 μL

CLDN3 Antibody

Sign In for Pricing
View Details
CLDN3 Antibody
KC-2308-02 100 µL

CLDN3 Antibody

Sign In for Pricing
View Details
CLDN3 Antibody
KC-2308-03 1 mL

CLDN3 Antibody

Sign In for Pricing
View Details
RAD9 homolog B (RAD9B) (NM_001286531) Human Tagged ORF Clone
RG237609 10 µg

RAD9 homolog B (RAD9B) (NM_001286531) Human Tagged ORF Clone

Sign In for Pricing
View Details