Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCUBE1 Peptide - N-terminal region

SCUBE1 Peptide - N-terminal region

Product Specifications

UniProt

Q86TI6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SCUBE1 Rabbit Polyclonal Antibody (orb586295) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_766638

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PGYKGEGKQCEDIDECENDYYNGGCVHECINIPGNYRCTCFDGFMLAHDG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BTN3A3 Recombinant Protein (Human)
RP003289 100 µg

BTN3A3 Recombinant Protein (Human)

Sign In for Pricing
View Details
AMBP (alpha-1-microglobulin/bikunin Precursor, EDC1, HCP, HI30, IATIL, ITI, ITIL, ITILC, UTI) (MaxLight 490)
243288-ML490 100 µL

AMBP (alpha-1-microglobulin/bikunin Precursor, EDC1, HCP, HI30, IATIL, ITI, ITIL, ITILC, UTI) (MaxLight 490)

Sign In for Pricing
View Details
PEX13 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-12620R-BF750 100 µL

PEX13 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Fmoc-D-Leu-OH
A7914-25000 25 g

Fmoc-D-Leu-OH

Sign In for Pricing
View Details
SCA3 Genemer Kit with Control DNA; 1 Kit
40-2039-10K 1 Kit

SCA3 Genemer Kit with Control DNA; 1 Kit

Sign In for Pricing
View Details
Indium Sulphate 99.0%
028555 10 g

Indium Sulphate 99.0%

Sign In for Pricing
View Details