Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCUBE1 Peptide - N-terminal region

SCUBE1 Peptide - N-terminal region

Product Specifications

UniProt

Q86TI6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SCUBE1 Rabbit Polyclonal Antibody (orb586295) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_766638

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PGYKGEGKQCEDIDECENDYYNGGCVHECINIPGNYRCTCFDGFMLAHDG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N6- (6-Aminohexyl) -ATP-Cy3
NU-805-CY3 40 µL

N6- (6-Aminohexyl) -ATP-Cy3

Sign In for Pricing
View Details
Adck1 3'UTR Lenti-reporter-Luc Vector
11385084 1.0 µg

Adck1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Heat Shock 70kDa Protein 1B (HSPA1B) Bovine ELISA Kit
D9507 96 Tests

Heat Shock 70kDa Protein 1B (HSPA1B) Bovine ELISA Kit

Sign In for Pricing
View Details
TGF beta 1 polyclonal antibody
orb1716578-01 50 µL

TGF beta 1 polyclonal antibody

Sign In for Pricing
View Details
TGF beta 1 polyclonal antibody
orb1716578-02 100 µL

TGF beta 1 polyclonal antibody

Sign In for Pricing
View Details
ABCE1, CT (ATP-binding cassette sub-family E member 1, ABCE1, RLI, RNASEL1, RNASELI, RNS4I) (Biotin) discontinued
031484-Biotin 200 µL

ABCE1, CT (ATP-binding cassette sub-family E member 1, ABCE1, RLI, RNASEL1, RNASELI, RNS4I) (Biotin) discontinued

Sign In for Pricing
View Details