SNTA1 Peptide - N-terminal region
SNTA1 Peptide - N-terminal region
Product Specifications
UniProt
B3KTR0
Field of Research
Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SNTA1 Rabbit Polyclonal Antibody (orb331331) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SPGPTPRNFSEAKHMSLKMAYVSKRCTPNDPEPRYLEICSADGQDTLFLR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![TCF12 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4D6G8]](https://cdn.genprice.uk/products/937/6868c3f4994c49e6dc402d08/imageurl/ta809696bm.webp)
TA809696BM 100 µL
TCF12 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4D6G8]
Sign In for Pricing
View Details ![FITC Anti-Mouse H-2 Antibody[M1/42]](https://cdn.genprice.uk/products/763/68dd14a5061270361e7d18c3/imageurl/e-ab-f1216c.webp)
