NBPF1 Peptide - C-terminal region
NBPF1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
AD2, NBG, AB13, AB14, AB23, NBPF
UniProt
Q3BBV0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NBPF1 Rabbit Polyclonal Antibody (orb55722) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_060410.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VLQDSLDRCYSTPSS CLEQPDSCQPYGSSFYALEEKHVGFSLDVGEIEK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC042988-500 1x 500 µL
BCL10 (MALT-Lymphoma Marker) (BL10/2988R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681671-100 1x 100 µL
Annexin A1 / (Hairy Cell Leukemia Marker) (ANXA1/1671), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details