Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NBPF1 Peptide - C-terminal region

NBPF1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AD2, NBG, AB13, AB14, AB23, NBPF

UniProt

Q3BBV0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NBPF1 Rabbit Polyclonal Antibody (orb55722) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060410.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VLQDSLDRCYSTPSS CLEQPDSCQPYGSSFYALEEKHVGFSLDVGEIEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSP50 (PRSS50) (NM_013270) Human Over-expression Lysate
LC402236 20 µg

TSP50 (PRSS50) (NM_013270) Human Over-expression Lysate

Sign In for Pricing
View Details
3-Hydroxy-17-oxo-estra-1,3,5(10)-triene-4-carboxylic Acid
TRC-H949903-5MG 5 mg

3-Hydroxy-17-oxo-estra-1,3,5(10)-triene-4-carboxylic Acid

Sign In for Pricing
View Details
HSV1 (Herpes Simplex Virus Type I) ICP8 (HSVI/2045), CF405S conjugate, 0.1mg/mL
BNC042045-100 1x 100 µL

HSV1 (Herpes Simplex Virus Type I) ICP8 (HSVI/2045), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(2,5-Dioxopyrrolidin-1-yl)acetic acid
TRC-B593303-25MG 25 mg

(2,5-Dioxopyrrolidin-1-yl)acetic acid

Sign In for Pricing
View Details
Recombinant PELI1 Antibody
RC-5344-01 50 μL

Recombinant PELI1 Antibody

Sign In for Pricing
View Details
Recombinant PELI1 Antibody
RC-5344-02 100 µL

Recombinant PELI1 Antibody

Sign In for Pricing
View Details