ATP6V0E2 Peptide - N-terminal region
ATP6V0E2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
ATP6V0E2L, C7orf32
UniProt
Q8NHE4
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ATP6V0E2 Rabbit Polyclonal Antibody (orb326705) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_660265
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQLNPLFGPQLKNETI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400009-100 1x 100 µL
MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040029-500 1x 500 µL
Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680679-100 1x 100 µL
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400218-100 1x 100 µL
CD100 (Semaphorin-4D) (A8), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details