Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1orf112 Peptide - C-terminal region

C1orf112 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RP1-97P20.1

UniProt

Q9NSG2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C1orf112 Rabbit Polyclonal Antibody (orb587093) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060656

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TEAAKVERVKQEKGIFWEPFANVTVEEAKRSSLQPYAKRARQEFPWEEEY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti--PRSV Coat protein Monoclonal Antibody, clone 9G2D3
CABT-NS1207 200 μg

Rabbit Anti--PRSV Coat protein Monoclonal Antibody, clone 9G2D3

Sign In for Pricing
View Details
KCNQ2 Human shRNA Lentiviral Particle (Locus ID 3785)
TL303805V 500 µL Each

KCNQ2 Human shRNA Lentiviral Particle (Locus ID 3785)

Sign In for Pricing
View Details
Col28a1 Mouse Gene Knockout Kit (CRISPR)
KN503633 1 Kit

Col28a1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CSTF1 Protein Lysate
OCOA16028-20UG 20 µg

CSTF1 Protein Lysate

Sign In for Pricing
View Details
Mouse Mrps21 activation kit by CRISPRa
GA206692 1 Kit

Mouse Mrps21 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary: left
CB617812 1 Block

Frozen Tissue Blocks, Ovary: left

Sign In for Pricing
View Details