C1orf112 Peptide - C-terminal region
C1orf112 Peptide - C-terminal region
Product Specifications
Product Name Alternative
RP1-97P20.1
UniProt
Q9NSG2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with C1orf112 Rabbit Polyclonal Antibody (orb587093) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_060656
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TEAAKVERVKQEKGIFWEPFANVTVEEAKRSSLQPYAKRARQEFPWEEEY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A2295-02R3-PE 100 µL
Angiotensin Converting Enzyme 2 (CT) (ACE 2, ACE2, ACE-2, ACE-related Carboxypeptidase, Angiotensin Converting Enzyme Homolog, ACEH, Angiotensin Converting Enzyme-like Protein, Angiotensin I Converting Enzyme (Peptidyl Dipeptidase A) 2, Angiotensin I Converting Enzyme 2, DKFZP434A014, EC 3.4.17, OTTHUMP00000022963) (PE)
Sign In for Pricing
View Details 
