Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADGB Peptide - C-terminal region

ADGB Peptide - C-terminal region

Product Specifications

Product Name Alternative

C6orf103

UniProt

Q8N7X0

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADGB Rabbit Polyclonal Antibody (orb326808) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078970

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SESGGVSSPGKEEREQSTRKENIQTGPRTRSPTILETSPRLIRKALEFMD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Hydroxy-L-pipecolic Acid Sodium Salt (~90%)
TRC-H702015-2.5MG 2.5 mg

N-Hydroxy-L-pipecolic Acid Sodium Salt (~90%)

Sign In for Pricing
View Details
CytoLinerTM 785/815 Fixed Cell Membrane Stain, 1000 labelings
#30140 1 Kit

CytoLinerTM 785/815 Fixed Cell Membrane Stain, 1000 labelings

Sign In for Pricing
View Details
Carbonic Anhydrase IV (CA4) (NM_000717) Human Recombinant Protein
TP720090XL 1 mg

Carbonic Anhydrase IV (CA4) (NM_000717) Human Recombinant Protein

Sign In for Pricing
View Details
Rbm7 Mouse Gene Knockout Kit (CRISPR)
KN514581 1 Kit

Rbm7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD268 / BAFFR / TNFRSF13C (BAFFR/1557), CF488A conjugate, 0.1mg/mL
BNC881557-100 1x 100 µL

CD268 / BAFFR / TNFRSF13C (BAFFR/1557), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (EGP40/826), CF647 conjugate, 0.1mg/mL
BNC470826-500 1x 500 µL

Ep-CAM / CD326 (EGP40/826), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details