ADGB Peptide - C-terminal region
ADGB Peptide - C-terminal region
Product Specifications
Product Name Alternative
C6orf103
UniProt
Q8N7X0
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ADGB Rabbit Polyclonal Antibody (orb326808) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_078970
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SESGGVSSPGKEEREQSTRKENIQTGPRTRSPTILETSPRLIRKALEFMD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC683338-500 1x 500 µL
CD11b / MAC-1 (Microglial Marker) (ITGAM/3338), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LY418913 100 µg
SNAP43 (SNAPC1) (NM_003082) Human Over-expression Lysate
Sign In for Pricing
View Details 
![AK3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4A2]](https://cdn.genprice.uk/products/937/6868c333994c49e6dc3f11a4/imageurl/ta501862am.webp)
TA501862AM 100 µL
AK3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4A2]
Sign In for Pricing
View Details