Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OIT3 Peptide - C-terminal region

OIT3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

LZP

UniProt

Q8WWZ8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OIT3 Rabbit Polyclonal Antibody (orb587245) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689848

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CRVLVCGVLDERSRCAQGCHRRMRRGAGGEDSAGLQGQTLTGGPIRIDWE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human OR7G1 qPCR Primer Pair
QH61417S 200 Tests

Human OR7G1 qPCR Primer Pair

Sign In for Pricing
View Details
Mouse Monoclonal TOX3 Antibody (TOX3/1124) - Azide and BSA Free
NBP2-47749-0.1mg 0.1 mg

Mouse Monoclonal TOX3 Antibody (TOX3/1124) - Azide and BSA Free

Sign In for Pricing
View Details
Anti-Connexin 40/GJA5 Antibody Picoband®, APC Conjugate
PA1368-APC 100 µg/Vial

Anti-Connexin 40/GJA5 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
ANKMY2 Mouse Monoclonal Antibody [Clone ID: OTI1C12]
TA507314 100 µL

ANKMY2 Mouse Monoclonal Antibody [Clone ID: OTI1C12]

Sign In for Pricing
View Details
MS4A13 (NM_001012417) Human Tagged ORF Clone Lentiviral Particle
RC215524L3V 200 µL

MS4A13 (NM_001012417) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
3′-O-azidomethyl-dCMP Sodium Salt
dNMP007-1 1 g

3′-O-azidomethyl-dCMP Sodium Salt

Sign In for Pricing
View Details