Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OIT3 Peptide - C-terminal region

OIT3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

LZP

UniProt

Q8WWZ8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OIT3 Rabbit Polyclonal Antibody (orb587245) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689848

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CRVLVCGVLDERSRCAQGCHRRMRRGAGGEDSAGLQGQTLTGGPIRIDWE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H-Leu-Leu-Gly-OH trifluroacetate
BL183701-01 0.005 g

H-Leu-Leu-Gly-OH trifluroacetate

Sign In for Pricing
View Details
H-Leu-Leu-Gly-OH trifluroacetate
BL183701-02 0.01 g

H-Leu-Leu-Gly-OH trifluroacetate

Sign In for Pricing
View Details
H-Leu-Leu-Gly-OH trifluroacetate
BL183701-03 0.025 g

H-Leu-Leu-Gly-OH trifluroacetate

Sign In for Pricing
View Details
H-Leu-Leu-Gly-OH trifluroacetate
BL183701-04 0.05 g

H-Leu-Leu-Gly-OH trifluroacetate

Sign In for Pricing
View Details
H-Leu-Leu-Gly-OH trifluroacetate
BL183701-05 0.1 g

H-Leu-Leu-Gly-OH trifluroacetate

Sign In for Pricing
View Details
Human Growth factor receptor-bound protein 10, GRB10 ELISA KIT
E7856Hu-01 48 Well

Human Growth factor receptor-bound protein 10, GRB10 ELISA KIT

Sign In for Pricing
View Details