Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD209 Peptide - C-terminal region

CD209 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CDSIGN, CLEC4L, DC-SIGN, DC-SIGN1

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD209 Rabbit Polyclonal Antibody (orb578531) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001138371

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTGS1 (Prostaglandin Endoperoxide Synthase 1) Mouse ELISA Kit
G5021 96 Tests

PTGS1 (Prostaglandin Endoperoxide Synthase 1) Mouse ELISA Kit

Sign In for Pricing
View Details
RGD735065 sgRNA CRISPR Lentivector (Rat) (Target 3)
K7226804 1.0 µg DNA

RGD735065 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
CSNK1G2 (Casein Kinase 1, gamma 2, CK1g2) (MaxLight 750) discontinued
245014-ML750 100 µL

CSNK1G2 (Casein Kinase 1, gamma 2, CK1g2) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Recombinant Leuconostoc citreum Ferredoxin--NADP reductase (LCK_00289)
MBS1101414-01 0.02 mg (E-Coli)

Recombinant Leuconostoc citreum Ferredoxin--NADP reductase (LCK_00289)

Sign In for Pricing
View Details
Recombinant Leuconostoc citreum Ferredoxin--NADP reductase (LCK_00289)
MBS1101414-02 0.02 mg (Yeast)

Recombinant Leuconostoc citreum Ferredoxin--NADP reductase (LCK_00289)

Sign In for Pricing
View Details
Recombinant Leuconostoc citreum Ferredoxin--NADP reductase (LCK_00289)
MBS1101414-03 0.1 mg (E-Coli)

Recombinant Leuconostoc citreum Ferredoxin--NADP reductase (LCK_00289)

Sign In for Pricing
View Details