Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD209 Peptide - C-terminal region

CD209 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CDSIGN, CLEC4L, DC-SIGN, DC-SIGN1

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD209 Rabbit Polyclonal Antibody (orb578531) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001138371

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSB Antibody
K70030M20C01C-01 50 ug

SSB Antibody

Sign In for Pricing
View Details
SSB Antibody
K70030M20C01C-02 100 ug

SSB Antibody

Sign In for Pricing
View Details
SSB Antibody
K70030M20C01C-03 1 mg

SSB Antibody

Sign In for Pricing
View Details
Mouse Gpr161 Pre-designed siRNA Set B
SI105757B 1 Each

Mouse Gpr161 Pre-designed siRNA Set B

Sign In for Pricing
View Details
PTPN13 Protein Vector (Human) (pPM-C-His)
PV114249 500 ng

PTPN13 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Human hsa-miR-4296 miRNA Agomir
abx881006-01 5 nmol

Human hsa-miR-4296 miRNA Agomir

Sign In for Pricing
View Details